DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and H1-3

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005311.1 Gene:H1-3 / 3007 HGNCID:4717 Length:221 Species:Homo sapiens


Alignment Length:270 Identity:101/270 - (37%)
Similarity:122/270 - (45%) Gaps:64/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERGG 65
            ||::|......|..|....|:||.  |||..:||  .:|||.    ||..::...::...|||.|
Human     1 MSETAPLAPTIPAPAEKTPVKKKA--KKAGATAG--KRKASG----PPVSELITKAVAASKERSG 57

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS-ASAKKEKDPK 128
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||: .:|..|..||
Human    58 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPK 120

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAK------ 187
            |                  ||.|.:..:...||| ||||.....||.|.:..|..:|.|      
Human   121 A------------------KKAGAAKPRKPAGAA-KKPKKVAGAATPKKSIKKTPKKVKKPATAA 166

  Fly   188 -----AKDAKKTGIIKSKPAA-TKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKK 246
                 ||.|||....:.|.|| :.||..|.||||       |||. |.|||.|            
Human   167 GTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKA-------AKPK-SGKPKVT------------ 211

  Fly   247 PKAKTTAAKK 256
             |||..|.||
Human   212 -KAKKAAPKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1-3NP_005311.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 18/49 (37%)
Linker_histone 39..109 CDD:278939 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..221 64/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.