DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and H1f6

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_036711.1 Gene:H1f6 / 24438 RGDID:2778 Length:208 Species:Rattus norvegicus


Alignment Length:237 Identity:86/237 - (36%)
Similarity:114/237 - (48%) Gaps:43/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAP---PATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKE 62
            ||::|.|.|::.|.||   |||  |:.|:|....:| .|.:..|.:...|....|.       :|
  Rat     1 MSETAPAASSTLVPAPVEKPAT--KRRGKKPGMATA-RKPRGFSVSKLIPEALSMS-------QE 55

  Fly    63 RGGSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKD 126
            |.|.||.|:||.:.|. |  |.:|....||..||..|..|.|:||||.|||||||||..|....|
  Rat    56 RAGMSLAALKKALAAAGY--DVEKNNSRIKLALKRLVNKGVLVQTKGTGASGSFKLSKKAASGND 118

  Fly   127 PKAKSKVLSAEKKVQSKKVASKKIGVS----SKKTAVGAADKKPKAKKAVATKKTAENKKTEKAK 187
             |.|.|        :|....:||:|:|    |.|::.....|||   ||..||.:...:||:.||
  Rat   119 -KGKGK--------KSASAKAKKLGLSRASRSPKSSKTKVVKKP---KATPTKGSGSRRKTKGAK 171

  Fly   188 AKDAKKTGIIKSKPAATKAKVT---AAKPKAVIAKASKAKPA 226
            ....:|:      ||  ||:.|   :.|.|.|:.|....|.|
  Rat   172 GLQQRKS------PA--KARATNSNSGKSKMVMQKTDLRKAA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 32/72 (44%)
H1f6NP_036711.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 16/40 (40%)
H15 36..116 CDD:238028 37/88 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..208 50/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.