DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and h1-6

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004913862.2 Gene:h1-6 / 100488538 XenbaseID:XB-GENE-5761117 Length:227 Species:Xenopus tropicalis


Alignment Length:240 Identity:93/240 - (38%)
Similarity:124/240 - (51%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERGG 65
            |:::|..|:.:|..|.||..:||..:|     .|.||||    |:.|...::...::...|||.|
 Frog     1 MTETAAETAPAPPPAEPAAAKKKQPKK-----GGAKAKK----PAGPSAAELIVKAVSASKERSG 56

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS---------AS 120
            .||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:         |:
 Frog    57 VSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKPLESKEKAA 119

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSK-----KTAVGAADKKPKAKKAVATKKTAEN 180
            .||...||||....:|:|..:|.| ..||:..::|     |....|| |.||..||...||.|::
 Frog   120 KKKPAAPKAKKPAAAAKKAPKSPK-KPKKVSAAAKSPKKVKKPAKAA-KSPKKSKAAKPKKVAKS 182

  Fly   181 KKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKP 225
            ...:.||.|.||......:||.|||:...||||||  |||.||.|
 Frog   183 PAKKAAKPKAAKSPAKKPTKPKATKSPAKAAKPKA--AKAKKAAP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
h1-6XP_004913862.2 H15 39..111 CDD:238028 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.