DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and LOC100485239

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031748935.1 Gene:LOC100485239 / 100485239 -ID:- Length:231 Species:Xenopus tropicalis


Alignment Length:238 Identity:92/238 - (38%)
Similarity:116/238 - (48%) Gaps:27/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VATSASPVAAP-PATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERGGSSLL 69
            :|.:|:|..|| |...|....:||.....|.||||    |:.|...::...::...|||.|.||.
 Frog     1 MAETAAPETAPAPPPAEPAAAKKKQPKKGGAKAKK----PAGPSAAELIVTAVSASKERSGVSLA 61

  Fly    70 AIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS---------ASAKKE 124
            .:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:         |:.||.
 Frog    62 TLKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKQLESKEKAAKKKP 124

  Fly   125 KDPKAKSKVLSAEKKVQSKKVASKKIGVSSK-----KTAVGAADKKPKAKKAVATKKTAENKKTE 184
            ..||||....:|.||........||:..::|     |....|| |.||..||...||.|::...:
 Frog   125 AAPKAKKPAAAAAKKAPKSPKKPKKVSAAAKSPKKVKKPAKAA-KSPKKPKAAKPKKVAKSPAKK 188

  Fly   185 KAKAKDAKKTGIIKSKPAATK--AKVTAAKPKAVIAKASKAKP 225
            .||.|.||.......||.|||  ||..||||||  |||.||.|
 Frog   189 AAKPKAAKSPAKKAPKPKATKSPAKAKAAKPKA--AKAKKAAP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 28/72 (39%)
LOC100485239XP_031748935.1 Linker_histone 42..109 CDD:395429 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm9433
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.