DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and XB5900552

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004913910.2 Gene:XB5900552 / 100145531 XenbaseID:XB-GENE-5900553 Length:224 Species:Xenopus tropicalis


Alignment Length:242 Identity:100/242 - (41%)
Similarity:123/242 - (50%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERGG 65
            ||::|.|    |..|.||..:||..:|     .|.||||    |:.|...::...::...|||.|
 Frog     1 MSETAPA----PPPAEPAAAKKKQPKK-----GGAKAKK----PAGPSAAELIVKAVSASKERSG 52

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.:|....:|..||:.|..|.|.|.||.||||||||:....:.|:..|
 Frog    53 VSLAALKKALAAGGY--DVEKNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKQLESKEKAA 115

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKK-TAVGAADKKPK-----AKKAVATK--KTAENKKTEKA 186
            |.|..:.:.|   |..|:||...|.|| ..|.||.|.||     ||.|.:.|  |.|:.||..|:
 Frog   116 KKKPAAPKAK---KPAAAKKAPKSPKKPKKVSAAAKSPKKVKKPAKAAKSPKKPKAAKPKKVAKS 177

  Fly   187 KAKDAKKTGIIKS------KPAATK--AKVTAAKPKAVIAKASKAKP 225
            .||.|.|....||      ||.|||  ||..||||||  |||.||.|
 Frog   178 PAKKAAKPKAAKSPAKKAPKPKATKSPAKAKAAKPKA--AKAKKAAP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
XB5900552XP_004913910.2 H15 35..106 CDD:238028 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.