DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33828 and H1f8

DIOPT Version :9

Sequence 1:NP_001027324.1 Gene:His1:CG33828 / 3771910 FlyBaseID:FBgn0053828 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001102821.1 Gene:H1f8 / 502875 RGDID:1566236 Length:332 Species:Rattus norvegicus


Alignment Length:301 Identity:86/301 - (28%)
Similarity:128/301 - (42%) Gaps:70/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDSAVATSASPVA---APPATVEKKVVQKKASGSAGTKAKKASATPS---------HPPTQQMVD 54
            |.|:|::|:|..:   :||             ||.|... ..|..||         :|...:||.
  Rat     5 SVSSVSSSSSVPSSDTSPP-------------GSCGLPG-AVSPDPSCSRIQVGQRNPTMLRMVL 55

  Fly    55 ASIKNLKERGGSSLLAIKKYITATY-KCDAQKLAPFIKKYLKSAVVNGKLIQ---TKGKGASGSF 115
            .::|..::|.|:|::|||.||...| .....:....:|:.|::.:..|.|.:   :|.|||:|||
  Rat    56 EALKAREKRQGTSVVAIKVYIQHKYPTVGTTRFKYLLKQALETGMRRGLLTRPANSKAKGATGSF 120

  Fly   116 KLSASAKKEKD--PKAK----------SKVLSAEKKVQSKKVASKKI----GVSSKKTAVGAA-- 162
            ||....||::.  |||:          ||.....||.|..|..::|.    |...|.....||  
  Rat   121 KLVPKPKKKRTCAPKARGGATGTKETGSKESGLRKKDQVGKAKTEKAAPNPGRKRKAYPCSAATL 185

  Fly   163 DKKPKAKKAVATKKTAENKKTEKA-----------KAK------DAKKTGIIKSKPAATKAKVTA 210
            :|.||..|||..:......|.:||           |.|      :|...|  |:|....|:|.:|
  Rat   186 EKAPKNAKAVPREVREAPLKRDKAAGAPLTANIGQKVKHSGTGQEADAHG--KTKDVCEKSKASA 248

  Fly   211 AKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKT 251
            :|.:..||...|.:.|..|..:..|:.|.   |.:|.||.|
  Rat   249 SKVQNSVASLIKKEMAAIAHMETVVQGAK---TVQKTKAPT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33828NP_001027324.1 Linker_histone 46..118 CDD:278939 25/75 (33%)
H1f8NP_001102821.1 H15 44..135 CDD:238028 28/90 (31%)
PTZ00121 <127..>329 CDD:173412 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.