DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33905 and H4c14

DIOPT Version :10

Sequence 1:NP_001027293.1 Gene:His4:CG33905 / 3771908 FlyBaseID:FBgn0053905 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_291074.1 Gene:H4c14 / 97122 MGIID:2140113 Length:103 Species:Mus musculus


Alignment Length:41 Identity:12/41 - (29%)
Similarity:23/41 - (56%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 QCRTTVQYV-GKNHFLKNIQEEILKVDAALRRPAEDIAVLD 220
            |||..:||: |...:...|:|  :..:.|:....::::|||
Mouse   225 QCRKALQYLWGLGEYKMEIEE--MSEEQAVIGEKQNMSVLD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33905NP_001027293.1 PLN00035 1..103 CDD:177669
H4c14NP_291074.1 PLN00035 1..103 CDD:177669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.