DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33905 and AT5G59970

DIOPT Version :9

Sequence 1:NP_001027293.1 Gene:His4:CG33905 / 3771908 FlyBaseID:FBgn0053905 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001332089.1 Gene:AT5G59970 / 836119 AraportID:AT5G59970 Length:103 Species:Arabidopsis thaliana


Alignment Length:103 Identity:100/103 - (97%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
plant     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||:|||||||||||||||||||||||||
plant    66 VIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33905NP_001027293.1 PLN00035 1..103 CDD:177669 98/101 (97%)
AT5G59970NP_001332089.1 PLN00035 1..103 CDD:177669 98/101 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100120
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.