DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33878 and HTB1

DIOPT Version :9

Sequence 1:NP_001027360.1 Gene:His2B:CG33878 / 3771891 FlyBaseID:FBgn0053878 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_172258.1 Gene:HTB1 / 837293 AraportID:AT1G07790 Length:148 Species:Arabidopsis thaliana


Alignment Length:130 Identity:90/130 - (69%)
Similarity:103/130 - (79%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKA-----GKAQKNITKT---DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSKAM 57
            |....|||:||     .||.|.:...   ||||||.:|  |:|.|||:|||||||||.|||||||
plant    19 PVEENKAAEKAPAEKKPKAGKKLPPKEAGDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAM 83

  Fly    58 SIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            .|||||:|||||::|.|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|||
plant    84 GIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148

  Fly   123  122
            plant   149  148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33878NP_001027360.1 H2B 33..121 CDD:197718 71/87 (82%)
HTB1NP_172258.1 valS <1..46 CDD:237855 9/26 (35%)
H2B 57..147 CDD:197718 71/89 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1530
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm2531
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.