DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33878 and AT3G53650

DIOPT Version :9

Sequence 1:NP_001027360.1 Gene:His2B:CG33878 / 3771891 FlyBaseID:FBgn0053878 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001319739.1 Gene:AT3G53650 / 28719403 AraportID:AT3G53650 Length:138 Species:Arabidopsis thaliana


Alignment Length:138 Identity:90/138 - (65%)
Similarity:107/138 - (77%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGK-----------AAKKAGKAQKNITK---TDKKKKRKRK--ESYAIYIYKVLKQVHPD 49
            |.||.:.|           .|:|..||:|.|||   ::||||:.:|  |:|.|||:|||||||||
plant     1 MAPKAAEKKPAGKKPAEKAPAEKLPKAEKKITKEGGSEKKKKKSKKNIETYKIYIFKVLKQVHPD 65

  Fly    50 TGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTK 114
            .|||.|||.|||||:|||||::|.|:||||.|||:.|||||||||||||:|||||:|||||||||
plant    66 IGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELSKHAVSEGTK 130

  Fly   115 AVTKYTSS 122
            ||||:|||
plant   131 AVTKFTSS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33878NP_001027360.1 H2B 33..121 CDD:197718 70/87 (80%)
AT3G53650NP_001319739.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1530
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm2531
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.