DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33878 and LOC101731959

DIOPT Version :9

Sequence 1:NP_001027360.1 Gene:His2B:CG33878 / 3771891 FlyBaseID:FBgn0053878 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_004913866.1 Gene:LOC101731959 / 101731959 -ID:- Length:126 Species:Xenopus tropicalis


Alignment Length:128 Identity:107/128 - (83%)
Similarity:112/128 - (87%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTDK---KKKRK-RKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..||||..|  |.:|||.|   ||:|| ||||||||:|||||||||||||||||||||
 Frog     1 MPDPAKSAPAAKKGSK--KAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||:|||||.||||||||||||||||||||||||||||||||||||||||||||||||:|
 Frog    64 NSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33878NP_001027360.1 H2B 33..121 CDD:197718 84/87 (97%)
LOC101731959XP_004913866.1 H2B 28..124 CDD:197718 90/95 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4606
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 193 1.000 Inparanoid score I3729
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm47745
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.