DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eys and txt-5

DIOPT Version :9

Sequence 1:NP_001027571.3 Gene:eys / 3771890 FlyBaseID:FBgn0031414 Length:2176 Species:Drosophila melanogaster
Sequence 2:NP_505019.2 Gene:txt-5 / 183289 WormBaseID:WBGene00016499 Length:356 Species:Caenorhabditis elegans


Alignment Length:301 Identity:70/301 - (23%)
Similarity:101/301 - (33%) Gaps:106/301 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TTRKSVTATRSLKLNPNILLPTLRILARGLLLPALILAILVGSSQAGFACLSNP---CVFGVCID 160
            :|.|:.:...||.|:.|||....|||.:..:|..:              .|.:|   |..|    
 Worm    15 STTKAQSRDDSLDLDENILSDVHRILQKRSILDNV--------------ALDDPRAECRNG---- 61

  Fly   161 GLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGVAY------------YNCTCPEGFS 213
            |:.:...|:||.|.||.:|: :::            ||.|::.            ..|.|..|:.
 Worm    62 GIYAGGICHCIKGQTGDKCE-HFE------------CVHGLSVGFRFDPESLLFSEPCICEVGWK 113

  Fly   214 GSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQHGGECIE 278
            |..|:....|    .|.|.|    ...|..|.|...|.||               .||:..:|:|
 Worm   114 GEMCDYRPAE----KCGNKG----EWKGDRCECVGSYFGS---------------ECQYTSKCVE 155

  Fly   279 GPGLEFTCDCPAGWHGRICQEEINECASSPCQNGGVCVDKLAAYACACPMGYTGINCEEEILICA 343
            |......|.|..|:.|..|.|.:....|...:|        ...:|.||..|||..||:      
 Worm   156 GFLRNGRCICDVGFEGDYCDEIVCVYGSPDFKN--------RTLSCDCPDKYTGRRCEQ------ 206

  Fly   344 DNPCQNNALCLMEEGVPTCYCVPDYHGEKCEFQYDECQLGP 384
               |:.                   ||...| .:..|:|.|
 Worm   207 ---CKK-------------------HGPLIE-PFPHCELDP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eysNP_001027571.3 EGF_CA 184..218 CDD:238011 7/45 (16%)
EGF_CA 220..256 CDD:238011 10/35 (29%)
EGF_CA <270..298 CDD:238011 9/27 (33%)
EGF_CA 301..336 CDD:238011 8/34 (24%)
EGF 342..371 CDD:278437 2/28 (7%)
EGF_CA 378..413 CDD:238011 3/7 (43%)
Laminin_G_2 1096..1244 CDD:280389
EGF_CA 1314..1346 CDD:238011
LamG 1355..1521 CDD:238058
EGF 1549..1578 CDD:278437
EGF_CA 1585..1621 CDD:238011
Laminin_G_2 1723..1856 CDD:280389
LamG 1956..2144 CDD:238058
txt-5NP_505019.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.