DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33810 and si:dkey-261m9.12

DIOPT Version :9

Sequence 1:NP_001027295.1 Gene:His1:CG33810 / 3771879 FlyBaseID:FBgn0053810 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017209709.1 Gene:si:dkey-261m9.12 / 560910 ZFINID:ZDB-GENE-131126-58 Length:199 Species:Danio rerio


Alignment Length:235 Identity:94/235 - (40%)
Similarity:119/235 - (50%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITA- 77
            |||||...||        .|.:|.||..     |..:.::..::...|||.|.||.|:||.::| 
Zfish     7 AAPPAKAPKK--------KAASKPKKTG-----PNVRDLIVKTVTASKERQGVSLAALKKALSAG 58

  Fly    78 TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQS 142
            .|  |.:|....:|..:|:.|:||.|:||||.||||||||:   ||:.:||              
Zfish    59 GY--DVEKNNSRVKIAVKALVLNGTLVQTKGTGASGSFKLN---KKQAEPK-------------- 104

  Fly   143 KKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEK-AKAKDAKKTGIIKSKPAATKA 206
            ||.|:||....:||.|...:.||.| |.|.|.|.|...||.:| |.||.|.|:.....||||.| 
Zfish   105 KKPAAKKTAAKAKKPAAKKSPKKVK-KPAAAKKATKSPKKAKKPAAAKKATKSPKKVKKPAAAK- 167

  Fly   207 KVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKK 246
            |.|.:..||.|||....||. :|||||        ||.||
Zfish   168 KATKSPKKAKVAKPKTVKPK-AAKPKK--------ATPKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33810NP_001027295.1 Linker_histone 46..118 CDD:278939 31/72 (43%)
si:dkey-261m9.12XP_017209709.1 Linker_histone 27..97 CDD:278939 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.