DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and YMR226C

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:71/259 - (27%)
Similarity:107/259 - (41%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTNKNVIFVAGLGGIGLDTSKELLKR---DLKNLVILDRIENPAAIAELKAI------NPKVTVT 60
            |..|.|:......|||..|:.|.|:.   |:|.::...|:|.   :.|||..      |.||.|.
Yeast    11 LAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEK---LEELKKTIDQEFPNAKVHVA 72

  Fly    61 FYPYDVTVPIAETTK-LLKTIFAQLKTVDVLINGA---------GILDDHQIERTIAVNYTGLVN 115
              ..|:|.  ||..| .::.:..:.|.:|:|:|.|         |.:....|:.....|.|.|:|
Yeast    73 --QLDITQ--AEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

  Fly   116 TTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT 180
            .|.|:|..:..:..|.   |.|:||:.|.:|.....:|..:|.||..||.||.|....|.:....
Yeast   134 ITQAVLPIFQAKNSGD---IVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVIL 195

  Fly   181 VNPGITRT--TLV-------HTFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAI 235
            :.||:..|  :||       ...|.:.|..|.:|:.:           |:..|.|....||..|
Yeast   196 IAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDV-----------ADLIVYATSRKQNTVI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 70/256 (27%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR42901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.