DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and Hpgd

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_077366.2 Gene:Hpgd / 79242 RGDID:620087 Length:266 Species:Rattus norvegicus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:116/248 - (46%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKNVIFVAGLG-GIGLDTSKELLKRDLKNLVILDRIEN----PAAIAELKAINPKVTVTFYPYDV 66
            |..|..|.|.. |||...::.||....|..::...:|.    .||:.|  ...|:.|: |...||
  Rat     4 NGKVALVTGAAQGIGKAFTEALLLHGAKVALVDWNLETGVKCKAALDE--QFEPQKTL-FIQCDV 65

  Fly    67 T--VPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKG 129
            .  ..:.:|.:.:...|.:|   |:|:|.||:.::...|:|:.:|...:::.|...||:..|:.|
  Rat    66 ADQKQLRDTFRKVVDHFGRL---DILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNG 127

  Fly   130 GPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPI--TGVTAYTVNPGITRTTLVH 192
            |.||||.||.|:.|...:.|.|||..:|..::.||.|.|..|.:  :||....:.||..:|.::.
  Rat   128 GEGGIIINISSIAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVKTPILE 192

  Fly   193 T------FNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQ-NGAIWKL 238
            :      ...:::...|:...:..:......|.|...:..||.:. ||||.|:
  Rat   193 SIEKEENMGQYIEYTDQIKAMMKFYGILDPSAIANGLINLIEDDALNGAIMKI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 68/247 (28%)
HpgdNP_077366.2 ADH_SDR_c_like 6..254 CDD:187584 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.