DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and CG4842

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster


Alignment Length:270 Identity:87/270 - (32%)
Similarity:132/270 - (48%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVP 69
            |..|||:::.|.||||....:|||:|.:|.|.|.|...|...:|:.|:.:|...|.::..|:|..
  Fly     3 LAGKNVVYLGGFGGIGQKCVQELLQRPIKALAIFDLNANEQLLAKWKSQHPDTDVFYHKLDITQK 67

  Fly    70 IAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGI 134
             ::.....|....:....||::||:|:::|..:|.||.:|..|::|:|...|::.||.|||.||:
  Fly    68 -SDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGGL 131

  Fly   135 ICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPI----TGVTAYTVNPGITRTTLVHTFN 195
            |.||.||.|......:.:||..|..|..||.::|.  |.    :||...|:.||.|.|.|:.   
  Fly   132 IVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMAN--PYFYAHSGVGFLTICPGFTDTGLLE--- 191

  Fly   196 SWLDVEPQVAEKLLAHPTQPSLA------------CAENFVKAIELNQNGAIWKLDLG-TLEA-- 245
                   .:..|.......|.||            ||.|.|.|||.::||.:..|::| |.|.  
  Fly   192 -------DIGNKTTFTYDTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGTVLMLEMGETTEVDM 249

  Fly   246 -IQWTKHWDS 254
             :.|....|:
  Fly   250 PVMWKPQLDN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 84/258 (33%)
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 83/253 (33%)
adh_short 6..194 CDD:278532 67/200 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455191
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.