DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and zgc:56585

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_956621.2 Gene:zgc:56585 / 393297 ZFINID:ZDB-GENE-040426-1084 Length:270 Species:Danio rerio


Alignment Length:199 Identity:61/199 - (30%)
Similarity:101/199 - (50%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELK-AINPKV---TVTFYPYD 65
            |.:|..:......|:|....:.|:|...| :.::|  .|.:...||| .:|.:.   ...||..|
Zfish     3 LKDKVAVVTGAAQGLGRSFVEILMKNGSK-VALID--VNKSLGEELKTTLNKEYGPNRAEFYTAD 64

  Fly    66 VTVPIAETTK-LLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKG 129
            |:  ..|..| :||.|..|...:|::.|.|||:::...|:|||:|..|:|..|...|::..|..|
Zfish    65 VS--SEEDFKGVLKKIVEQFGQIDIMCNNAGIINEKHWEKTIAINLGGVVRGTYLALEYMKKENG 127

  Fly   130 GPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPIT--GVTAYTVNPGITRTTLVH 192
            |.||:|.|:.|:.|...:...|:|:.||..||.|:.::|.::..:  ||....:.|...:|:|:.
Zfish   128 GSGGVIVNVASMAGLGPLPVAPIYTATKHGVVGFSRAMAVVSKFSNYGVRINVLCPWFVKTSLLS 192

  Fly   193 TFNS 196
            ..||
Zfish   193 LLNS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 60/196 (31%)
zgc:56585NP_956621.2 ADH_SDR_c_like 6..254 CDD:187584 60/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134459
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.