DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and Adhr

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:254 Identity:98/254 - (38%)
Similarity:143/254 - (56%) Gaps:8/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVT 67
            |.||.|:|.:||..|||.|:|||.|:.:::..|.||...|||.|||:|::|.|...:.|:.||||
  Fly     2 FDLTGKHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVT 66

  Fly    68 VPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPG 132
            :...:..|....:..|:..:|||||||.:.|::.|:.||..|.||::||...:|.:.|::.||.|
  Fly    67 MAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTG 131

  Fly   133 GIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPI----TGVTAYTVNPGITRTTLVHT 193
            |:|.|:.||.|.:.......||.:|..|:.||.|||.  |:    .||....|..|.||..:...
  Fly   132 GLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLAD--PLYYSQNGVAVMAVCCGPTRVFVDRE 194

  Fly   194 FNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHW 252
            ..::|:.....|::|...|.|.:..|.:|.|.|||.::||.||..|.|.||.::  .||
  Fly   195 LKAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVK--LHW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 93/242 (38%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 93/242 (38%)
adh_short 7..195 CDD:278532 74/189 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.