DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and HPGD

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_000851.2 Gene:HPGD / 3248 HGNCID:5154 Length:266 Species:Homo sapiens


Alignment Length:249 Identity:67/249 - (26%)
Similarity:118/249 - (47%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKNVIFVAGLG-GIGLDTSKELLKRDLKNLVILD-----RIENPAAIAELKAINPKVTVTFYPYD 65
            |..|..|.|.. |||...::.||.:..| :.::|     .::..||:.|  ...|:.|: |...|
Human     4 NGKVALVTGAAQGIGRAFAEALLLKGAK-VALVDWNLEAGVQCKAALDE--QFEPQKTL-FIQCD 64

  Fly    66 VT--VPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRK 128
            |.  ..:.:|.:.:...|.:|   |:|:|.||:.::...|:|:.:|...:::.|...||:..|:.
Human    65 VADQQQLRDTFRKVVDHFGRL---DILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQN 126

  Fly   129 GGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPI--TGVTAYTVNPGITRTTLV 191
            ||.||||.|:.|:.|...:.|.|||..:|..:|.||.|.|..|.:  :||....:.||...|.::
Human   127 GGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAIL 191

  Fly   192 HT------FNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQ-NGAIWKL 238
            .:      ...:::.:..:.:.:..:........|...:..||.:. ||||.|:
Human   192 ESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 66/248 (27%)
HPGDNP_000851.2 ADH_SDR_c_like 6..254 CDD:187584 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.