DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adh and SPAC521.03

DIOPT Version :9

Sequence 1:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:73/261 - (27%)
Similarity:112/261 - (42%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTNKNVIFVAGLGGIGLDTSKELLK-RDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTV 68
            |..|.::......|||..|:.|:.| ..:|.::...|......||  |.:..|..|:..|..:.|
pombe     4 LDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIA--KELESKYEVSVLPLKLDV 66

  Fly    69 -PIAETTKLLKTIFAQLKTVDVLINGAGI-----------LDDHQIERTIAVNYTGLVNTTTAIL 121
             .:.....:::::..:...:|||||.||:           :||  ....|..|..|::..|.|:|
pombe    67 SDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDD--AVTMITTNVLGMMAMTRAVL 129

  Fly   122 D-FWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGI 185
            . |:.|.||.    |.|:||:.|..:.....||..||:|:..|||:|.|....|.:....|:||:
pombe   130 PIFYSKNKGD----ILNVGSIAGRESYVGGSVYCSTKSALAQFTSALRKETIDTRIRIMEVDPGL 190

  Fly   186 TRTTL-VHTF--------NSWLDVEP----QVAEKLLAHPTQPSLACAENFVKAIEL----NQNG 233
            ..|.. |..|        |.:.:.||    .:||.:|.     :|...||.|.|..|    :|.|
pombe   191 VETEFSVVRFHGDKQKADNVYKNSEPLTPEDIAEVILF-----ALTRRENVVIADTLVFPSHQGG 250

  Fly   234 A 234
            |
pombe   251 A 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 72/258 (28%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 70/257 (27%)
SDR_c5 7..256 CDD:187604 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR42901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.