DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG13250

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:130 Identity:27/130 - (20%)
Similarity:51/130 - (39%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CGLVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYI-----KSVNRSYKYVSIKAKLFK 65
            |.||..:....|:........:.:|.|:.:|...::...|.|     |..|....::.::..:.|
  Fly    14 CCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTK 78

  Fly    66 TPITKINGVILKRFNGYNGYRPF--MFNITLDACRFMN-NTKSNPIASYLYDFIRPFTNMNHNCP 127
            ..:....|.|..|.:     ||.  :|.|.:|.|..:. .:||..:.:.|:..::. .|....||
  Fly    79 MWVELSVGQIANRKD-----RPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNYPDACP 137

  Fly   128  127
              Fly   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 15/60 (25%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.