DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG13590

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:174 Identity:54/174 - (31%)
Similarity:87/174 - (50%) Gaps:13/174 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALLALSISIVEIS----SKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT 69
            |.:.|:|:.:..:|    ...:.||.:|.|.:|.:....||.:|:.:|:...::|.. .|..|..
  Fly     5 VFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINV-TFVEPAR 68

  Fly    70 KINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVI 134
            .|: |..|.....|||:||:|:.|.|||.||.. ::.|:|..::..||..:.:||.|||      
  Fly    69 NIS-VHFKTMKKANGYKPFLFDYTFDACEFMRR-RNQPVAKIIWYMIRNVSTINHTCPY------ 125

  Fly   135 EKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGT 178
            |.|.:....|:|...:|:|.||||...:|:.....:....||.|
  Fly   126 EGLQMLSDFHKVDIPVPLPSGDYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 32/86 (37%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.