DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG13589

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:154 Identity:49/154 - (31%)
Similarity:81/154 - (52%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGVILKRFNGYNGYRPFMF 90
            :.||.:|.|.:|.:....||.:|:.:|:...::|.| .|..|...|. :.:|.....|||:||:|
  Fly    26 KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINA-TFIEPAKNIY-LHMKMMKKANGYKPFLF 88

  Fly    91 NITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEKLPIHFVNHQVTKVLPVPEG 155
            :.|.|||.||.. ::.|.|..:::.|:..:.:||.|||      |.|.:....|.:...:|:|.|
  Fly    89 DYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPY------EGLQMLSDFHHIDVPVPLPSG 146

  Fly   156 DYLYETNWMAYDIR-RAVVKVYGT 178
            |||...:|: :|.: :....||.|
  Fly   147 DYLLLLDWI-FDFKPQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 29/86 (34%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 32/95 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.