DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG13561

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:166 Identity:45/166 - (27%)
Similarity:88/166 - (53%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGVILKRFNGY 82
            |:::....:||||.|.|.|:.|:....|.:.:|.|....:|::|.:.:.|...:: :.::.....
  Fly    16 ILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVS-MRMQLLKKA 79

  Fly    83 NGYRPFMFNI-TLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIE--KLPIHFVNH 144
            :||:||::|| ..|.|.::.. :::|..:.:.......||:| .||...::|:|  :.|:     
  Fly    80 SGYKPFLYNICQSDVCEYLEK-RNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPV----- 137

  Fly   145 QVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180
            :|..::|:|.|||...|.:..:....|.||||.|::
  Fly   138 KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 22/89 (25%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.