DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33757

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:90/174 - (51%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGV- 74
            |..:.:.:..:..:.:|.::.|.:.|:.:.:...|.||::||....:||:.:..:|    :|.| 
  Fly     6 LFFVLVLLTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRT----VNNVH 66

  Fly    75 -ILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNM-NHNCPY--------- 128
             .|:.|...||:|||::||:.:.|.|::. ::|.|.|..|::::|:..| |:.||:         
  Fly    67 MRLELFKRANGWRPFLYNISFNLCDFLSK-RNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCT 130

  Fly   129 DHDLVIEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAV 172
            |.:..|||..:.|         |:..|:|..:   :::.::|.|
  Fly   131 DLEFDIEKFRVRF---------PIETGEYALQ---LSFIVQRKV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 29/98 (30%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 28/94 (30%)

Return to query results.
Submit another query.