DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33658

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:164 Identity:74/164 - (45%)
Similarity:114/164 - (69%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFK-TPITKINGVILK 77
            ::.:..:|.|..||||..|.|:.|..:|.|||::|||||:|:|:|.:.|:.| ....|:|..:.:
  Fly    17 IAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQ 81

  Fly    78 RFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEKLPIHFV 142
            :.   |||:||::|||:|.|:||.|||||.:|.|.|||||..:|:||:|||:||:::|||....:
  Fly    82 QI---NGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETI 143

  Fly   143 NHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVY 176
            |.::.|.||.|.|:|:::|.|:|.:..|.|.|:|
  Fly   144 NSRLPKTLPFPTGNYMFQTYWIANEKYRVVTKIY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 42/86 (49%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 42/75 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.