DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33723

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:88/174 - (50%)
Similarity:126/174 - (72%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITK-- 70
            ||:||.|.:.:.||..:.||||:.|.|::|.|::|..|.:||:||:|||:|.|..|.|.||||  
  Fly     9 LVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKAR 73

  Fly    71 INGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIE 135
            :|..:.|||   ||||||::|.|||||.|..:.|:||:|.|.:|.|:.::|:||:|||::|:::|
  Fly    74 VNFGLYKRF---NGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVE 135

  Fly   136 KLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTI 179
            |:....|||.|||:||.|||||:.||:||..||...|::||.|:
  Fly   136 KVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 45/86 (52%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 46/87 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.