DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33758

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:188 Identity:53/188 - (28%)
Similarity:100/188 - (53%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVALLALSISIV---EISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT 69
            ::|||..::.::   |:.:||:  ::.|.:.|:.|.:|..|.:|:::|....:|::.|| |.|::
  Fly     1 MLALLFFTLLVLTSTEVEAKFK--SLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKL-KQPVS 62

  Fly    70 KINGVILKRFNGYNGYRPFMFNITLDACRFM--NNTKSNPIASYLYDFIRPFTNMNHNCPY---- 128
            || .:.|:.|...||:|||::|.|.:.|.|:  ||   |.|....|.::||:...|::||:    
  Fly    63 KI-FIRLEFFKRANGWRPFLYNFTANLCDFLARNN---NVIMGIGYAYLRPYLVKNYSCPFKVIE 123

  Fly   129 -------DHDLVIEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTI 179
                   |.:|.|..|...|         |:..|:|..:..::|.:  :|.:.:.|:|
  Fly   124 NELLECKDFELDINNLRNRF---------PIETGEYALQLTFIAKN--KAALTINGSI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 29/99 (29%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 29/97 (30%)

Return to query results.
Submit another query.