DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33792

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:75/176 - (42%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKIN---GVILKRFNGYNGYR 86
            |:.....|.:....||:.. |.:|.||.:...:::...: |..:|.|.   .|..|  :..|.|:
  Fly    31 FKIRKTECIANGAYFSNVS-CILKPVNWTRSVLNMDGDI-KEALTDIKMSVEVFYK--DSSNLYK 91

  Fly    87 PFMFNITLDACRFM-NNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEK-------------- 136
            ||......|.|:.: |.|:||.:..|....:..:||:||:|||...|.|..              
  Fly    92 PFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMF 156

  Fly   137 LPIHFV--NHQVTKV-LPV-PEGDYLYETNWMAYD--IRRAVVKVY 176
            |..|.:  |.::.:| ||: |..||....|:...:  |...:|.:|
  Fly   157 LKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIHLGLVLIY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 31/108 (29%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 30/102 (29%)

Return to query results.
Submit another query.