DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33752

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:91/172 - (52%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKI--NGV 74
            |:|.|:...|:   ..||:.|..|||.|::|..|.:..:.|.....|:..|..|.||.||  |..
  Fly    14 LSLEINGESIT---RHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFT 75

  Fly    75 ILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYD-----HDLVI 134
            :.|:.:||:   ||:||:|:|.|.:|.:.....|..|.|..::|::|.||:|||:     ||:::
  Fly    76 VYKKLSGYH---PFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILV 137

  Fly   135 EKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVY 176
            :...:  .:....|: |:|.|:|::.......|:.|.|:..|
  Fly   138 KDFVL--TDTMFAKI-PLPTGNYMFSIKLATDDVWRVVLNTY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 29/93 (31%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.