DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33927

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:159 Identity:48/159 - (30%)
Similarity:92/159 - (57%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVALLALSISIVEI-SSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITK- 70
            ||....:::.:..| :|:|:|||.:|:|:::.:.....|.:|::.|....:|....:.|| |:| 
  Fly    10 LVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT-ISKF 73

  Fly    71 -INGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVI 134
             ::|.|.||   .||::|:::|||.|.|||:......|:. .:::.::.|:|:|..|||...:.|
  Fly    74 RVHGQIFKR---ANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTCPYMGPVHI 134

  Fly   135 EKLPIHFVNHQVTKVLPVPEGDYLYETNW 163
              :.:|.:..|:.  :|:|.|:||.:..|
  Fly   135 --MGLHIIGEQIP--VPLPTGEYLIQIKW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 27/86 (31%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 28/87 (32%)

Return to query results.
Submit another query.