DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33689

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:59/160 - (36%)
Similarity:92/160 - (57%) Gaps:2/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGVILKRFNG 81
            |::.|.:...||||.|.|.|..|:.|:.|:||:|||::|||.:...|:|.||..|. :..:....
  Fly    13 SLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNIT-ISFRLMRH 76

  Fly    82 YNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEKLPIHFVNHQV 146
            .:||:||..:.|.|.|:|:.|.| :||....|...:..:|:||.||||||::::.|....:....
  Fly    77 DHGYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDF 140

  Fly   147 TKVLPVPEGDYLYETNWMAYDIRRAVVKVY 176
            .|.:|:..|||...:||...:|.||.:.:|
  Fly   141 LKYIPMINGDYAVYSNWSTDNIMRAYLNLY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 28/86 (33%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446124
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.