DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33453

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:169 Identity:53/169 - (31%)
Similarity:94/169 - (55%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALLAL-SISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKIN 72
            |.|.|| .||.|..:...:.||::|.|::|.::.|.||.:|:.:|:...::|.| .|..|...::
  Fly    10 VFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINA-TFLHPTNNVS 73

  Fly    73 GVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEKL 137
             :.||.....:||:||:|::|:|||:|:.. :.||:....|.||:.::.:||.|||...:|.:  
  Fly    74 -LRLKMVKRLSGYKPFLFDVTIDACQFLRK-RHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSD-- 134

  Fly   138 PIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVY 176
                 .|.....:|:|.|||....:::.|..::..|.:|
  Fly   135 -----YHTAVFPVPLPSGDYGVLLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 28/86 (33%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.