DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33454

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:160 Identity:53/160 - (33%)
Similarity:93/160 - (58%) Gaps:14/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALLALSISIVEI----SSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT 69
            |.:|.:.:::|.:    |:..:.||::|.|.||..:.|.||.:|:.:|:...:.|.| .|..||.
  Fly     5 VIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINA-TFLHPIN 68

  Fly    70 KINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVI 134
            .|: |..:.....|||:||:|:||:|||:|:.. .:||:...:|:.|:..:|:||:|||. .:|:
  Fly    69 SIS-VRFQMLKRANGYKPFLFDITVDACQFLRK-PNNPVIKIVYNMIKDASNINHSCPYG-TVVL 130

  Fly   135 EKLPIHFVNHQVTKVLPVPEGDYLYETNWM 164
            ...      |:::..||.|.||||...:::
  Fly   131 NDF------HRISLPLPFPSGDYLSRLDFL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 31/86 (36%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.