DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33463

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:175 Identity:82/175 - (46%)
Similarity:127/175 - (72%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVALLALSISIVEISSK----FEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPI 68
            |..||.|.:: ::::||    .||.||.|.::||:||:|||||:|||||:|||:|:|.||.:.|:
  Fly     5 LSLLLTLWLA-MQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPV 68

  Fly    69 T--KINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHD 131
            |  |:||.:.:|   :|||:||::|||:|.|:.:.|.|.:|:|||.:|..:.|:||||:||::||
  Fly    69 TNAKVNGALFQR---HNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHD 130

  Fly   132 LVIEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVY 176
            ::::||....|.|::|.:||.|||||:.:.||....|.|.:.||:
  Fly   131 IILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 40/86 (47%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 41/87 (47%)

Return to query results.
Submit another query.