DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33476

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:146 Identity:33/146 - (22%)
Similarity:52/146 - (35%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SKFEFTNIMCNSLDKQFSDFEY-------CYIKSVNRSYKYVSIKAKLFKTPITKINGVILKRFN 80
            ||| ....:..|.|..|.::.:       .|...|.:..|..:|.   |...:.|...|:.|..|
  Fly    17 SKF-IMESLATSCDHNFVEYFHKAPDMVDIYTFRVVKLAKAFTID---FAVRVVKTKRVMYKVDN 77

  Fly    81 GYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMN-HNCPYDHDLVIEKLPIHFV-N 143
                         .|.|:|:.|...|.:...:|.  |...|.: .:||.       |..:::: |
  Fly    78 -------------FDGCQFLMNPLMNRVFGTVYK--RLVVNGSFFSCPI-------KPGVYYIRN 120

  Fly   144 HQVTKVLPV--PEGDY 157
            .....:|||  |.|.|
  Fly   121 EGSVAMLPVFQPPGRY 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 21/91 (23%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 24/105 (23%)

Return to query results.
Submit another query.