DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33477

DIOPT Version :10

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:127 Identity:27/127 - (21%)
Similarity:43/127 - (33%) Gaps:33/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVN--HCGLVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAK- 62
            |.||  |...:.|..|...:.|    .|..:::|.:|.|..:..:...::..|..|...|:..: 
  Fly     1 MAVNRGHIFYLCLFGLLFFVEE----HEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRC 61

  Fly    63 -------LFKTPITKINGVILKRFNGYNGYRPFMFNITL---------------DACRFMNN 102
                   ..:.|.:|    ||..|........|..|||:               ..|.|:||
  Fly    62 DHDFVEYFHRVPDSK----ILYTFRVVKLAPAFTINITIKVLKTHRIMYKIENFKGCEFLNN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 11/47 (23%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 4/20 (20%)

Return to query results.
Submit another query.