DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33920 and CG33483

DIOPT Version :9

Sequence 1:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:174 Identity:88/174 - (50%)
Similarity:124/174 - (71%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT--KI 71
            |.:..:.::.|:|:|..|||||.|.|.||.|.|||||::||||||:||:|:|..|.|.|||  |:
  Fly    59 VRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKV 123

  Fly    72 NGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIEK 136
            |..:||||   |||:||::|||:|||:.:.::|.|||.|:.|...:..:||||.||:||||::||
  Fly   124 NFSLLKRF---NGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEK 185

  Fly   137 LPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180
            ||.:|:|.:|...:..|.||||:.::|.||.|.||.|..:.|:|
  Fly   186 LPTNFMNQKVNGDIKFPHGDYLFHSDWYAYGINRATVDFFLTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 42/86 (49%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 43/87 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.