DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and RDL2

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_014929.3 Gene:RDL2 / 854460 SGDID:S000005812 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:41/110 - (37%)
Similarity:61/110 - (55%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEQVKDVPNHPD--VYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPE 65
            |::||:::..||:  ..|:|||..:|::... :|.:||||::....||.|....|...:..:||.
Yeast    34 TFDQVRNLVEHPNDKKLLVDVREPKEVKDYK-MPTTINIPVNSAPGALGLPEKEFHKVFQFAKPP 97

  Fly    66 KQSPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKEG 110
            ....:||.|..|.|...||::|:|.||.|..||.||..||..|.|
Yeast    98 HDKELIFLCAKGVRAKTAEELARSYGYENTGIYPGSITEWLAKGG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 39/105 (37%)
RDL2NP_014929.3 RHOD_HSP67B2 33..139 CDD:238777 39/105 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345450
Domainoid 1 1.000 77 1.000 Domainoid score I2083
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1606
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm9162
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 1 1.000 - - X3454
TreeFam 1 0.960 - -
1211.880

Return to query results.
Submit another query.