DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and STR16

DIOPT Version :10

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_851278.1 Gene:STR16 / 836734 AraportID:AT5G66040 Length:120 Species:Arabidopsis thaliana


Alignment Length:103 Identity:31/103 - (30%)
Similarity:44/103 - (42%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAF-KN---------KYGRSKPEKQSPIIFT 73
            :|||..||..| |....:||:|.      :|...|.. ||         .:|:|     ..||..
plant    27 LDVRTPEEFSQ-GHACGAINVPY------MNRGASGMSKNPDFLEQVSSHFGQS-----DNIIVG 79

  Fly    74 CRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKEGL 111
            |:||.|.::|.......|::.|....|.::.|| |.||
plant    80 CQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWA-KNGL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 27/97 (28%)
STR16NP_851278.1 RHOD 10..118 CDD:444705 31/103 (30%)

Return to query results.
Submit another query.