DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and AT2G17850

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001324888.1 Gene:AT2G17850 / 816295 AraportID:AT2G17850 Length:188 Species:Arabidopsis thaliana


Alignment Length:145 Identity:29/145 - (20%)
Similarity:45/145 - (31%) Gaps:48/145 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NHPDVYLIDVRRKEELQQTGFIPASINIPL-------------------------------DELD 45
            :.|.|..|||.:.::|..:|:....:.:.|                               :|..
plant    28 SEPKVITIDVNQAQKLLDSGYTFLDVRLILKPFRFSHAFIVVRYYCLVISEILRAVKHRTVEEFK 92

  Fly    46 KALNLDGSAFKNKYGRSKPEKQ--SP---------------IIFTCRSGNRVLEAEKIAKSQGYS 93
            |......:.|...|....|:.|  :|               :|..|:||.|.|.|.|...|.|:.
plant    93 KGHVDSENVFNVPYWLYTPQGQEINPNFLKHVSSLCNQTDHLILGCKSGVRSLHATKFLVSSGFK 157

  Fly    94 NVVIYKGSWNEWAQK 108
            .|....|.:..|..|
plant   158 TVRNMDGGYIAWVNK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 28/142 (20%)
AT2G17850NP_001324888.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2670
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.