DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and tstd3

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001186943.1 Gene:tstd3 / 564087 ZFINID:ZDB-GENE-100922-224 Length:179 Species:Danio rerio


Alignment Length:107 Identity:44/107 - (41%)
Similarity:62/107 - (57%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQ 67
            :|||:|.:.......:||||...||::.|.|..|||:||.:::.||.|....||.|||...|.|.
Zfish    67 SYEQLKKLLVSGSSVVIDVREPWELREYGNIQGSINVPLGQVNGALQLTPDEFKEKYGGDMPSKS 131

  Fly    68 SPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKE 109
            ..|:|:|.:|.|...|.:.|.|.||:.|..:.|.|.|||::|
Zfish   132 QNIVFSCLAGVRSKHALEAAVSLGYTKVQHFPGGWQEWAERE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 42/103 (41%)
tstd3NP_001186943.1 RHOD_HSP67B2 66..171 CDD:238777 42/103 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 102 1.000 Inparanoid score I4961
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm6478
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 1 1.000 - - X3454
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.