DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and tstd1

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_021328470.1 Gene:tstd1 / 563265 ZFINID:ZDB-GENE-081107-63 Length:121 Species:Danio rerio


Alignment Length:113 Identity:40/113 - (35%)
Similarity:65/113 - (57%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIP----LDELDKALNLDGSAFKNKYGRSK 63
            :|..:|.:.......|:|||..||:.: |.||.||:||    :..:.:.|:||.:.|::|:|..|
Zfish     9 SYSDLKSILAKGSAVLVDVRTNEEVAR-GTIPGSIHIPEFHLVGNIGQDLSLDAAEFQSKFGVGK 72

  Fly    64 PEKQ-SPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKEG 110
            |... :.::|.|:.|.|...|.:.|||.|:.|...|.|::.||::|||
Zfish    73 PPLDCTELVFFCQLGRRGAAATEKAKSLGFKNARNYAGAYKEWSEKEG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 37/108 (34%)
tstd1XP_021328470.1 RHOD 9..117 CDD:320771 37/108 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8512
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm6450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44086
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.