DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and LOC561325

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001313378.1 Gene:LOC561325 / 561325 -ID:- Length:158 Species:Danio rerio


Alignment Length:110 Identity:51/110 - (46%)
Similarity:67/110 - (60%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPE-K 66
            ||||:|.:.:...|.|||||..:|| ..||||.:.||||.||::||.||...|:.:||.|||. .
Zfish    50 TYEQLKHMMSTGRVQLIDVREPDEL-TAGFIPGATNIPLGELEEALTLDPDQFRQRYGVSKPHPD 113

  Fly    67 QSPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKEGL 111
            .|.|:..|:.|.|.|.|.:||....||....|.|.::|||::|.|
Zfish   114 DSDIVLYCQRGVRSLNALEIAIRLEYSRARHYVGGYSEWAERERL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 48/104 (46%)
LOC561325NP_001313378.1 RHOD 49..154 CDD:294087 48/104 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8512
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm6450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.