DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and Tstd3

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_575783.3 Gene:Tstd3 / 500420 RGDID:1563572 Length:157 Species:Rattus norvegicus


Alignment Length:107 Identity:45/107 - (42%)
Similarity:65/107 - (60%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQ 67
            ||.::|::.|..|:.|||||...|:.:.|.||.|:||||||:.:||.::...||.|||..||.|.
  Rat    44 TYRELKNLLNSKDIMLIDVRNTWEILEHGKIPGSVNIPLDEVGEALQMNPREFKEKYGEEKPSKS 108

  Fly    68 SPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKE 109
            ..::|:|.:|.|..:|...|.|.|:::...|.|.|.||...|
  Rat   109 DRLVFSCLAGVRSKKAMDTAISLGFNSAQHYIGGWTEWVTYE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 44/103 (43%)
Tstd3XP_575783.3 RHOD_HSP67B2 43..148 CDD:238777 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7407
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 97 1.000 Inparanoid score I4933
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm44470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3454
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.