DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and CG6000

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001287495.1 Gene:CG6000 / 42851 FlyBaseID:FBgn0039145 Length:154 Species:Drosophila melanogaster


Alignment Length:108 Identity:54/108 - (50%)
Similarity:74/108 - (68%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQS 68
            |:.||.:|:.|...|||||..|||::||.|||||||||..:.:.|......||:||||.||:.::
  Fly    45 YDVVKKLPSEPQKLLIDVREPEELKETGQIPASINIPLGVVSQELAASEQLFKSKYGREKPKPET 109

  Fly    69 PIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKEGL 111
            .|||.|:.|.|.|:|.:.|.:.|:.||..|:|||.:||::|||
  Fly   110 EIIFHCKIGKRSLKAAEAAAALGFKNVKNYQGSWLDWAEREGL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 50/102 (49%)
CG6000NP_001287495.1 RHOD_HSP67B2 43..148 CDD:238777 50/102 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464033
Domainoid 1 1.000 75 1.000 Domainoid score I9063
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2670
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm6450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.