DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and CG12279

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster


Alignment Length:109 Identity:58/109 - (53%)
Similarity:76/109 - (69%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPE 65
            |||||:|||:||||:.||.|||.:.||::||.:||||||||.||:|||||....|...|||.||.
  Fly     1 MATYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPA 65

  Fly    66 KQSPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKE 109
            ..:.:||:|::|.|...|..:|.:.|::|...|.|||.||..|:
  Fly    66 VDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEWQAKQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 56/104 (54%)
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 56/104 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461712
Domainoid 1 1.000 44 1.000 Domainoid score I4683
eggNOG 1 0.900 - - E1_COG0607
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 45 1.000 Inparanoid score I2670
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm42406
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 1 1.000 - - X3454
1211.930

Return to query results.
Submit another query.