DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and Tstd1

DIOPT Version :10

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001157997.1 Gene:Tstd1 / 226654 MGIID:3648482 Length:133 Species:Mus musculus


Alignment Length:36 Identity:11/36 - (30%)
Similarity:17/36 - (47%) Gaps:6/36 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FDSHRDSW-IRKLRLDLGYHHDKYDLMSWIDAATTR 116
            :|..||.: .|:.|     |.|:||...:.|...:|
Mouse   447 YDDRRDRYDDRRDR-----HDDRYDSDRYSDRYDSR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 9/25 (36%)
Tstd1NP_001157997.1 RHOD_HSP67B2 25..130 CDD:238777
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.