DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4456 and si:ch211-161h7.8

DIOPT Version :9

Sequence 1:NP_001027116.1 Gene:CG4456 / 3771872 FlyBaseID:FBgn0001228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_001340407.1 Gene:si:ch211-161h7.8 / 100000133 ZFINID:ZDB-GENE-091204-302 Length:157 Species:Danio rerio


Alignment Length:110 Identity:42/110 - (38%)
Similarity:62/110 - (56%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPE 65
            :.||||:|.:..:..|.|.|||..:|. |.|.||.|:|:||.||:.:|.|....|:.::....|:
Zfish    47 VVTYEQLKGMLANHSVQLFDVRNPDEF-QAGRIPDSVNVPLGELEVSLKLPAEKFEEQFKVKAPQ 110

  Fly    66 K-QSPIIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQKE 109
            | ...|:|.||||.|.|.|.:.|...|:|....|.|.:.:|.::|
Zfish   111 KADDNIVFHCRSGKRSLTALETAHRLGFSKARHYAGGYIDWEERE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4456NP_001027116.1 RHOD_HSP67B2 2..107 CDD:238777 41/105 (39%)
si:ch211-161h7.8XP_001340407.1 RHOD 48..151 CDD:294087 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8512
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm6450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.