DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33669 and CG33666

DIOPT Version :9

Sequence 1:NP_001027043.2 Gene:CG33669 / 3771864 FlyBaseID:FBgn0053669 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001027046.2 Gene:CG33666 / 3771730 FlyBaseID:FBgn0053666 Length:160 Species:Drosophila melanogaster


Alignment Length:160 Identity:157/160 - (98%)
Similarity:160/160 - (100%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKSSHKLKPNWLSRSKKYKLSDPSMIIRDIRQERALQQKFLSDTRSMTDLMQQLLDGNMLHGD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||:||||
  Fly     1 MSFKSSHKLKPNWLSRSKKYKLSDPSMIIRDIRQERALQQKFLSDTRSMTDLMQQLLNGNILHGD 65

  Fly    66 VISSHFLEFPKSRCVHFEFCPEIERRRTTKIYNMRRSVQRALEYVVQNSIVRPKIEDDVEESQME 130
            ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||
  Fly    66 VISSHFLEFPKSRCVHFEFCPEIERRRTTKIYNMRRSVQRALEYIVQNSIVRPKIEDDVEESQME 130

  Fly   131 INNGCGAVVIDTIAAAFENSKDVNLTDKRD 160
            ||||||||||||||||||||||||||||||
  Fly   131 INNGCGAVVIDTIAAAFENSKDVNLTDKRD 160



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009977
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.